KIAA1324 antibody (70R-6707)

Rabbit polyclonal KIAA1324 antibody raised against the N terminal of KIAA1324

Synonyms Polyclonal KIAA1324 antibody, Anti-KIAA1324 antibody, MGC150624 antibody, KIAA1324, Kiaa1324 antibody, KIAA 1324 antibody, KIAA 1324, EIG121 antibody, KIAA-1324, KIAA-1324 antibody, RP11-352P4.1 antibody
Specificity KIAA1324 antibody was raised against the N terminal of KIAA1324
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen KIAA1324 antibody was raised using the N terminal of KIAA1324 corresponding to a region with amino acids PCAEGRYSLGTGIRFDEWDELPHGFASLSANMELDDSAAESTGNCTSSKW
Assay Information KIAA1324 Blocking Peptide, catalog no. 33R-6992, is also available for use as a blocking control in assays to test for specificity of this KIAA1324 antibody

Images

Western Blot analysis using KIAA1324 antibody (70R-6707)

KIAA1324 antibody (70R-6707) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 111 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of KIAA1324 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance KIAA1324 belongs to the UPF0577 family. It may play a role as a marker of hyperestrogenic state and estrogen-related type I endometrial carcinoma.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using KIAA1324 antibody (70R-6707) | KIAA1324 antibody (70R-6707) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors