KIAA1430 antibody (70R-3136)

Rabbit polyclonal KIAA1430 antibody raised against the middle region of KIAA1430

Synonyms Polyclonal KIAA1430 antibody, Anti-KIAA1430 antibody, KIAA1430, DKFZp434F1728 antibody, KIAA 1430, FLJ21225 antibody, KIAA-1430 antibody, KIAA-1430, Kiaa1430 antibody, KIAA 1430 antibody
Specificity KIAA1430 antibody was raised against the middle region of KIAA1430
Cross Reactivity Human
Applications WB
Immunogen KIAA1430 antibody was raised using the middle region of KIAA1430 corresponding to a region with amino acids NMGYLNSSPLSRRARSTLGQYSPLRASRTSSATSGLSCRSERSAVDPSSG
Assay Information KIAA1430 Blocking Peptide, catalog no. 33R-6794, is also available for use as a blocking control in assays to test for specificity of this KIAA1430 antibody

Images

Western Blot analysis using KIAA1430 antibody (70R-3136)

KIAA1430 antibody (70R-3136) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 59 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of KIAA1430 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of KIAA1430 protein is not widely studied, and is yet to be elucidated fully.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using KIAA1430 antibody (70R-3136) | KIAA1430 antibody (70R-3136) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors