KIAA1754L antibody (70R-6820)

Rabbit polyclonal KIAA1754L antibody raised against the C terminal of KIAA1754L

Synonyms Polyclonal KIAA1754L antibody, Anti-KIAA1754L antibody, KIAAL-1754 antibody, KIAAL 1754, KIAAL 1754 antibody, KIAAL-1754, KIAA1754L, Kiaa1754-Like antibody
Specificity KIAA1754L antibody was raised against the C terminal of KIAA1754L
Cross Reactivity Human
Applications WB
Immunogen KIAA1754L antibody was raised using the C terminal of KIAA1754L corresponding to a region with amino acids EHLFLKLVGRFAPENTCHLKCLQIILSLRQHQSLPHGASRPILTSYHFKT
Assay Information KIAA1754L Blocking Peptide, catalog no. 33R-2453, is also available for use as a blocking control in assays to test for specificity of this KIAA1754L antibody

Images

Western Blot analysis using KIAA1754L antibody (70R-6820)

KIAA1754L antibody (70R-6820) used at 0.25 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 61 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of KIAA1754L antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of KIAA1754L protein is not widely studied, and is yet to be elucidated fully.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using KIAA1754L antibody (70R-6820) | KIAA1754L antibody (70R-6820) used at 0.25 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors