KIF12 antibody (70R-5602)

Rabbit polyclonal KIF12 antibody raised against the N terminal of KIF12

Synonyms Polyclonal KIF12 antibody, Anti-KIF12 antibody, KIF-12 antibody, KIF-12, KIF12, RP11-56P10.3 antibody, KIF 12 antibody, Kinesin Family Member 12 antibody, KIF 12
Specificity KIF12 antibody was raised against the N terminal of KIF12
Cross Reactivity Human
Applications WB
Immunogen KIF12 antibody was raised using the N terminal of KIF12 corresponding to a region with amino acids SLGSPRPLPVRWNKTRGFYVEQLRVVEFGSLEALMELLQTGLSRRRNSAH
Assay Information KIF12 Blocking Peptide, catalog no. 33R-8585, is also available for use as a blocking control in assays to test for specificity of this KIF12 antibody

Images

Western Blot analysis using KIF12 antibody (70R-5602)

KIF12 antibody (70R-5602) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 56 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of KIF12 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance KIF12 is a member of the kinesin superfamily of microtubule-associated molecular motors that play important roles in intracellular transport and cell division.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using KIF12 antibody (70R-5602) | KIF12 antibody (70R-5602) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors