KIF13B antibody (70R-5670)

Rabbit polyclonal KIF13B antibody raised against the N terminal of KIF13B

Synonyms Polyclonal KIF13B antibody, Anti-KIF13B antibody, KIFB-13, KIF13B, Kinesin Family Member 13B antibody, KIFB-13 antibody, GAKIN antibody, KIFB 13, KIAA0639 antibody, KIFB 13 antibody
Specificity KIF13B antibody was raised against the N terminal of KIF13B
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen KIF13B antibody was raised using the N terminal of KIF13B corresponding to a region with amino acids SGKSYTMMGTADQPGLIPRLCSGLFERTQKEENEEQSFKVEVSYMEIYNE
Assay Information KIF13B Blocking Peptide, catalog no. 33R-8472, is also available for use as a blocking control in assays to test for specificity of this KIF13B antibody

Images

Immunohistochemical staining using KIF13B antibody (70R-5670)

KIF13B antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 203 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of KIF13B antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance KIF13B may be involved in reorganization of the cortical cytoskeleton. KIF13B may be functionally important for the intracellular trafficking of MAGUKs and associated protein complexes.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Immunohistochemical staining using KIF13B antibody (70R-5670) | KIF13B antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X
  • Western Blot analysis using KIF13B antibody (70R-5670) | KIF13B antibody (70R-5670) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors