KIF15 antibody (70R-5561)

Rabbit polyclonal KIF15 antibody raised against the middle region of KIF15

Synonyms Polyclonal KIF15 antibody, Anti-KIF15 antibody, KIF-15 antibody, KNSL7 antibody, KIF15, KIF 15, FLJ25667 antibody, HKLP2 antibody, KIF 15 antibody, Kinesin Family Member 15 antibody, NY-BR-62 antibody, KIF-15
Specificity KIF15 antibody was raised against the middle region of KIF15
Cross Reactivity Human
Applications WB
Immunogen KIF15 antibody was raised using the middle region of KIF15 corresponding to a region with amino acids SKKHSGLLQSAQEELTKKEALIQELQHKLNQKKEEVEQKKNEYNFKMRQL
Assay Information KIF15 Blocking Peptide, catalog no. 33R-8556, is also available for use as a blocking control in assays to test for specificity of this KIF15 antibody


Western Blot analysis using KIF15 antibody (70R-5561)

KIF15 antibody (70R-5561) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 160 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of KIF15 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance KIF15 is the plus-end directed kinesin-like motor enzyme involved in mitotic spindle assembly.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using KIF15 antibody (70R-5561) | KIF15 antibody (70R-5561) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors