KIF22 antibody (70R-1616)

Rabbit polyclonal KIF22 antibody raised against the C terminal of KIF22

Synonyms Polyclonal KIF22 antibody, Anti-KIF22 antibody, KIF-22, KID antibody, OBP-1 antibody, KNSL4 antibody, OBP antibody, OBP-2 antibody, KIF22, Kinesin Family Member 22 antibody, KIF 22, KIF-22 antibody, KIF 22 antibody
Specificity KIF22 antibody was raised against the C terminal of KIF22
Cross Reactivity Human
Applications WB
Immunogen KIF22 antibody was raised using the C terminal of KIF22 corresponding to a region with amino acids LASQGSQGAPLLSTPKRERMVLMKTVEEKDLEIERLKTKQKELEAKMLAQ
Assay Information KIF22 Blocking Peptide, catalog no. 33R-4798, is also available for use as a blocking control in assays to test for specificity of this KIF22 antibody


Western Blot analysis using KIF22 antibody (70R-1616)

KIF22 antibody (70R-1616) used at 2.5 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 73 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of KIF22 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance KIF22 a member of kinesin-like protein family. This family of proteins are microtubule-dependent molecular motors that transport organelles within cells and move chromosomes during cell division. The C-terminal half of this protein has been shown to bind DNA. Studies with the Xenopus homolog suggests its essential role in metaphase chromosome alignment and maintenance.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using KIF22 antibody (70R-1616) | KIF22 antibody (70R-1616) used at 2.5 ug/ml to detect target protein.

Availability: In stock

Price: $275.00
Size: 100 ug
View Our Distributors