KIF22 antibody (70R-5549)

Rabbit polyclonal KIF22 antibody raised against the N terminal of KIF22

Synonyms Polyclonal KIF22 antibody, Anti-KIF22 antibody, KNSL4 antibody, Kinesin Family Member 22 antibody, KIF-22 antibody, OBP antibody, KIF 22 antibody, KIF 22, OBP-1 antibody, OBP-2 antibody, KIF-22, KID antibody, KIF22
Specificity KIF22 antibody was raised against the N terminal of KIF22
Cross Reactivity Human
Applications WB
Immunogen KIF22 antibody was raised using the N terminal of KIF22 corresponding to a region with amino acids CSLEIANWRNHQETLKYQFDAFYGERSTQQDIYAGSVQPILRHLLEGQNA
Assay Information KIF22 Blocking Peptide, catalog no. 33R-1809, is also available for use as a blocking control in assays to test for specificity of this KIF22 antibody


Western Blot analysis using KIF22 antibody (70R-5549)

KIF22 antibody (70R-5549) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 73 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of KIF22 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance KIF22 a member of kinesin-like protein family. This family of proteins are microtubule-dependent molecular motors that transport organelles within cells and move chromosomes during cell division. The C-terminal half of this protein has been shown to bind DNA. Studies with the Xenopus homolog suggests its essential role in metaphase chromosome alignment and maintenance.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using KIF22 antibody (70R-5549) | KIF22 antibody (70R-5549) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors