KIF23 antibody (70R-5544)

Rabbit polyclonal KIF23 antibody raised against the N terminal of KIF23

Synonyms Polyclonal KIF23 antibody, Anti-KIF23 antibody, Kinesin Family Member 23 antibody, KIF-23 antibody, KIF23, KIF 23, KIF 23 antibody, KIF-23
Specificity KIF23 antibody was raised against the N terminal of KIF23
Cross Reactivity Human,Mouse,Rat,Dog
Applications WB
Immunogen KIF23 antibody was raised using the N terminal of KIF23 corresponding to a region with amino acids VRPLGFPDQECCIEVINNTTVQLHTPEGYRLNRNGDYKETQYSFKQVFGT
Assay Information KIF23 Blocking Peptide, catalog no. 33R-9781, is also available for use as a blocking control in assays to test for specificity of this KIF23 antibody


Western Blot analysis using KIF23 antibody (70R-5544)

KIF23 antibody (70R-5544) used at 0.5 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 98 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of KIF23 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance KIF23 is a member of kinesin-like protein family. This family includes microtubule-dependent molecular motors that transport organelles within cells and move chromosomes during cell division. This protein has been shown to cross-bridge antiparallel microtubules and drive microtubule movement in vitro. Alternate splicing of this gene results in two transcript variants encoding two different isoforms.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using KIF23 antibody (70R-5544) | KIF23 antibody (70R-5544) used at 0.5 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors