KIF23 antibody (70R-5564)

Rabbit polyclonal KIF23 antibody raised against the middle region of KIF23

Synonyms Polyclonal KIF23 antibody, Anti-KIF23 antibody, MKLP-1 antibody, KIF-23 antibody, KIF23, KIF 23, Kinesin Family Member 23 antibody, KNSL5 antibody, CHO1 antibody, KIF 23 antibody, KIF-23, MKLP1 antibody
Specificity KIF23 antibody was raised against the middle region of KIF23
Cross Reactivity Human
Applications WB
Immunogen KIF23 antibody was raised using the middle region of KIF23 corresponding to a region with amino acids KDEKLKQLKAIVTEPKTEKPERPSRERDREKVTQRSVSPSPVPLLFQPDQ
Assay Information KIF23 Blocking Peptide, catalog no. 33R-4282, is also available for use as a blocking control in assays to test for specificity of this KIF23 antibody

Images

Western Blot analysis using KIF23 antibody (70R-5564)

KIF23 antibody (70R-5564) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 98 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of KIF23 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance KIF23 is a member of kinesin-like protein family. This family includes microtubule-dependent molecular motors that transport organelles within cells and move chromosomes during cell division. This protein has been shown to cross-bridge antiparallel microtubules and drive microtubule movement in vitro. Alternate splicing of this gene results in two transcript variants encoding two different isoforms.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using KIF23 antibody (70R-5564) | KIF23 antibody (70R-5564) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors