KIF25 antibody (70R-5562)

Rabbit polyclonal KIF25 antibody raised against the N terminal of KIF25

Synonyms Polyclonal KIF25 antibody, Anti-KIF25 antibody, KNSL3 antibody, KIF 25, KIF 25 antibody, KIF25, Kinesin Family Member 25 antibody, MGC163361 antibody, KIF-25 antibody, KIF-25
Specificity KIF25 antibody was raised against the N terminal of KIF25
Cross Reactivity Human
Applications WB
Immunogen KIF25 antibody was raised using the N terminal of KIF25 corresponding to a region with amino acids TWTSGQLQREKQARPGSGAVLAFPDDKDLRVYGPAESQSAVFGDVCPLLT
Assay Information KIF25 Blocking Peptide, catalog no. 33R-9383, is also available for use as a blocking control in assays to test for specificity of this KIF25 antibody


Western Blot analysis using KIF25 antibody (70R-5562)

KIF25 antibody (70R-5562) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 35 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of KIF25 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The protein encoded by the KIF25 gene is a member of the kinesin-like protein family. Protein family members are microtubule-dependent molecular motors that transport organelles within cells and move chromosomes during cell division. However, the particular function of this gene product has not yet been determined. Two alternatively spliced transcript variants which encode products have been described. Other splice variants have been found that lack exon 2 and the initiation codon for translation.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using KIF25 antibody (70R-5562) | KIF25 antibody (70R-5562) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors