KIF2B antibody (70R-5604)

Rabbit polyclonal KIF2B antibody raised against the middle region of KIF2B

Synonyms Polyclonal KIF2B antibody, Anti-KIF2B antibody, KIFB-2 antibody, KIF2B, Kinesin Family Member 2B antibody, KIFB-2, KIFB 2, KIFB 2 antibody
Specificity KIF2B antibody was raised against the middle region of KIF2B
Cross Reactivity Human
Applications WB
Immunogen KIF2B antibody was raised using the middle region of KIF2B corresponding to a region with amino acids DCSKGIYALVAQDVFLLLRNSTYEKLDLKVYGTFFEIYGGKVYDLLNWKK
Assay Information KIF2B Blocking Peptide, catalog no. 33R-1874, is also available for use as a blocking control in assays to test for specificity of this KIF2B antibody


Western Blot analysis using KIF2B antibody (70R-5604)

KIF2B antibody (70R-5604) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 76 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of KIF2B antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance KIF2B is the plus end-directed microtubule-dependent motor required for spindle assembly and chromosome movement. KIF2B has microtubule depolymerization activity.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using KIF2B antibody (70R-5604) | KIF2B antibody (70R-5604) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors