KIF3A antibody (70R-5601)

Rabbit polyclonal KIF3A antibody raised against the C terminal of KIF3A

Synonyms Polyclonal KIF3A antibody, Anti-KIF3A antibody, KIFA 3 antibody, KIF3A, KIFA-3 antibody, KIFA 3, Kinesin Family Member 3A antibody, KIFA-3
Specificity KIF3A antibody was raised against the C terminal of KIF3A
Cross Reactivity Human,Dog
Applications WB
Immunogen KIF3A antibody was raised using the C terminal of KIF3A corresponding to a region with amino acids PVPDKKEKDPFEVDLSHVYLAYTEESLRQSLMKLERPRTSKGKARPKTGR
Assay Information KIF3A Blocking Peptide, catalog no. 33R-7417, is also available for use as a blocking control in assays to test for specificity of this KIF3A antibody


Western Blot analysis using KIF3A antibody (70R-5601)

KIF3A antibody (70R-5601) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 80 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of KIF3A antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance KIF3A/B is a kinesin involved in intraflagellar transport and Golgi trafficking.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using KIF3A antibody (70R-5601) | KIF3A antibody (70R-5601) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors