KIF5B antibody (70R-5599)

Rabbit polyclonal KIF5B antibody raised against the N terminal of KIF5B

Synonyms Polyclonal KIF5B antibody, Anti-KIF5B antibody, KIFB 5, KIFB 5 antibody, KIFB-5 antibody, Kinesin Family Member 5B antibody, KIFB-5, KIF5B
Specificity KIF5B antibody was raised against the N terminal of KIF5B
Cross Reactivity Human
Applications IHC, WB
Immunogen KIF5B antibody was raised using the N terminal of KIF5B corresponding to a region with amino acids CNIKVMCRFRPLNESEVNRGDKYIAKFQGEDTVVIASKPYAFDRVFQSST
Assay Information KIF5B Blocking Peptide, catalog no. 33R-1753, is also available for use as a blocking control in assays to test for specificity of this KIF5B antibody


Immunohistochemical staining using KIF5B antibody (70R-5599)

KIF5B antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Hepatocytes (arrows) in Human Liver. Magnification is at 400X


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 110 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of KIF5B antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Kinesin is the founding member of a superfamily of microtubule based motor proteins that perform force-generating tasks such as organelle transport and chromosome segregation. Kinesin consists of heavy and light chains both of which have been documented to bind a variety of potential linker or cargo proteins. KIF5B is an isoform of kinesin heavy chain.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using KIF5B antibody (70R-5599) | KIF5B antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Hepatocytes (arrows) in Human Liver. Magnification is at 400X
  • Western Blot analysis using KIF5B antibody (70R-5599) | KIF5B antibody (70R-5599) used at 0.5 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors