KIF5C antibody (70R-3465)

Rabbit polyclonal KIF5C antibody raised against the N terminal of KIF5C

Synonyms Polyclonal KIF5C antibody, Anti-KIF5C antibody, KIFC-5, NKHC antibody, KIF5C, NKHC-2 antibody, MGC111478 antibody, FLJ44735 antibody, KINN antibody, KIFC 5, Kinesin Family Member 5C antibody, KIFC 5 antibody, KIFC-5 antibody, KIAA0531 antibody, NKHC2 antibody
Specificity KIF5C antibody was raised against the N terminal of KIF5C
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen KIF5C antibody was raised using the N terminal of KIF5C corresponding to a region with amino acids TVVIGQGKPYVFDRVLPPNTTQEQVYNACAKQIVKDVLEGYNGTIFAYGQ
Assay Information KIF5C Blocking Peptide, catalog no. 33R-9375, is also available for use as a blocking control in assays to test for specificity of this KIF5C antibody

Images

Western Blot analysis using KIF5C antibody (70R-3465)

KIF5C antibody (70R-3465) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 109 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of KIF5C antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance KIF5C belongs to the kinesin-like protein family, Kinesin subfamily. It contains 1 kinesin-motor domain. Kinesin is a microtubule-associated force-producing protein that may play a role in organelle transport.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using KIF5C antibody (70R-3465) | KIF5C antibody (70R-3465) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors