KIFAP3 antibody (70R-3247)

Rabbit polyclonal KIFAP3 antibody raised against the middle region of KIFAP3

Synonyms Polyclonal KIFAP3 antibody, Anti-KIFAP3 antibody, KAP3 antibody, dJ190I16.1 antibody, Kinesin-Associated Protein 3 antibody, FLJ22818 antibody, Smg-GDS antibody, SMAP antibody
Specificity KIFAP3 antibody was raised against the middle region of KIFAP3
Cross Reactivity Human
Applications WB
Immunogen KIFAP3 antibody was raised using the middle region of KIFAP3 corresponding to a region with amino acids WLEMVESRQMDESEQYLYGDDRIEPYIHEGDILERPDLFYNSDGLIASEG
Assay Information KIFAP3 Blocking Peptide, catalog no. 33R-9970, is also available for use as a blocking control in assays to test for specificity of this KIFAP3 antibody

Images

Western Blot analysis using KIFAP3 antibody (70R-3247)

KIFAP3 antibody (70R-3247) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 91 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of KIFAP3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The small G protein GDP dissociation stimulator (smg GDS) is a regulator protein having two activities on a group of small G proteins including the Rho and Rap1 family members and Ki-Ras; one is to stimulate their GDP/GTP exchange reactions, and the other is to inhibit their interactions with membranes.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using KIFAP3 antibody (70R-3247) | KIFAP3 antibody (70R-3247) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors