KIFC3 antibody (70R-5600)

Rabbit polyclonal KIFC3 antibody raised against the C terminal of KIFC3

Synonyms Polyclonal KIFC3 antibody, Anti-KIFC3 antibody, Kinesin Family Member C3 antibody, DKFZp686D23201 antibody
Specificity KIFC3 antibody was raised against the C terminal of KIFC3
Cross Reactivity Human
Applications WB
Immunogen KIFC3 antibody was raised using the C terminal of KIFC3 corresponding to a region with amino acids EHLEWEPACQTPQPSARAHSAPSSGTSSRPGSIRRKLQPSGKSRPLPV
Assay Information KIFC3 Blocking Peptide, catalog no. 33R-2452, is also available for use as a blocking control in assays to test for specificity of this KIFC3 antibody

Images

Western Blot analysis using KIFC3 antibody (70R-5600)

KIFC3 antibody (70R-5600) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 93 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of KIFC3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance KIFC3 belongs to the kinesin-like protein family. It contains 1 kinesin-motor domain. KIFC3 is the minus-end microtubule-dependent motor protein. It is involved in apically targeted transport.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using KIFC3 antibody (70R-5600) | KIFC3 antibody (70R-5600) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors