Kinectin 1 antibody (70R-6709)

Rabbit polyclonal Kinectin 1 antibody

Synonyms Polyclonal Kinectin 1 antibody, Anti-Kinectin 1 antibody, Kinesin Receptor antibody, KIAA0004 antibody, MU-RMS-40.19 antibody, MGC133337 antibody, CG1 antibody, KNT antibody, KTN1 antibody
Cross Reactivity Human,Mouse
Applications WB
Immunogen Kinectin 1 antibody was raised using a synthetic peptide corresponding to a region with amino acids EELLKVISEREKEISGLWNELDSLKDAVEHQRKKNNDLREKNWEAMEALA
Assay Information Kinectin 1 Blocking Peptide, catalog no. 33R-2373, is also available for use as a blocking control in assays to test for specificity of this Kinectin 1 antibody

Images

Western Blot analysis using Kinectin 1 antibody (70R-6709)

Kinectin 1 antibody (70R-6709) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 150 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of KTN1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Various cellular organelles and vesicles are transported along the microtubules in the cytoplasm. Likewise, membrane recycling of the endoplasmic reticulum (ER), Golgi assembly at the microtubule organizing center, and alignment of lysosomes along microtubules are all related processes. The transport of organelles requires a special class of microtubule-associated proteins (MAPs). One of these is the molecular motor kinesin, an ATPase that moves vesicles unidirectionally toward the plus end of the microtubule.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using Kinectin 1 antibody (70R-6709) | Kinectin 1 antibody (70R-6709) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors