KIR2DL4 antibody (70R-2365)
Rabbit polyclonal KIR2DL4 antibody raised against the middle region of KIR2DL4
Overview
Overview
Synonyms | Polyclonal KIR2DL4 antibody, Anti-KIR2DL4 antibody, KIRDL4-2, KIR2DL4, CD158D antibody, KIR103AS antibody, KIRDL4 2 antibody, KIRDL4-2 antibody, G9P antibody, KIRDL4 2, Killer Cell Immunoglobulin-Like Receptor Two Domains Long Cytoplasmic Tail 4 antibody, KIR103 antibody |
---|---|
Specificity | KIR2DL4 antibody was raised against the middle region of KIR2DL4 |
Cross Reactivity | Human |
Applications | WB |
Immunogen | KIR2DL4 antibody was raised using the middle region of KIR2DL4 corresponding to a region with amino acids VSVTGNPSSSWPSPTEPSFKTGIARHLHAVIRYSVAIILFTILPFFLLHR |
Assay Information | KIR2DL4 Blocking Peptide, catalog no. 33R-9831, is also available for use as a blocking control in assays to test for specificity of this KIR2DL4 antibody |
Images
Western Blot analysis using KIR2DL4 antibody (70R-2365)
KIR2DL4 antibody (70R-2365) used at 1 ug/ml to detect target protein.
Specifications
Host | Rabbit |
---|---|
Method of Purification | Affinity purified |
Molecular Weight | 30 kDa (MW of target protein) |
Form & Buffer | Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of KIR2DL4 antibody in PBS |
Concentration | 1 mg/ml |
Usage & Assay Information
Usage Recommendations | WB: 1 ug/ml |
---|
Storage & Safety
Storage | Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles. |
---|
General Information
Biological Significance | Killer cell immunoglobulin-like receptors (KIRs) are transmembrane glycoproteins expressed by natural killer cells and subsets of T cells. |
---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product