KIRREL antibody (70R-6888)

Rabbit polyclonal KIRREL antibody

Synonyms Polyclonal KIRREL antibody, Anti-KIRREL antibody, MGC129543 antibody, NEPH1 antibody, Kin Of Irre Like antibody, MGC129542 antibody, FLJ10845 antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen KIRREL antibody was raised using a synthetic peptide corresponding to a region with amino acids FLEVGTLERYTVERTNSGSGVLSTLTINNVMEADFQTHYNCTAWNSFGPG
Assay Information KIRREL Blocking Peptide, catalog no. 33R-2959, is also available for use as a blocking control in assays to test for specificity of this KIRREL antibody

Images

Western Blot analysis using KIRREL antibody (70R-6888)

KIRREL antibody (70R-6888) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 66 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of KIRREL antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance KIRREL (NEPH1) is a member of the nephrin-like protein family, which includes NEPH2 and NEPH3. The cytoplasmic domains of these proteins interact with the C terminus of podocin (NPHS2), and the genes are expressed in kidney podocytes, cells involved in ensuring size- and charge-selective ultrafiltration.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using KIRREL antibody (70R-6888) | KIRREL antibody (70R-6888) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors