KIRREL2 antibody (70R-6136)

Rabbit polyclonal KIRREL2 antibody

Synonyms Polyclonal KIRREL2 antibody, Anti-KIRREL2 antibody, Kin Of Irre Like 2 antibody, DKFZP564A1164 antibody, MGC15718 antibody, FILTRIN antibody, NEPH3 antibody, NLG1 antibody
Cross Reactivity Human
Applications WB
Immunogen KIRREL2 antibody was raised using a synthetic peptide corresponding to a region with amino acids WSRYWISGNAANGQHDLHIRPVELEDEASYECQATQAGLRSRPAQLHVLV
Assay Information KIRREL2 Blocking Peptide, catalog no. 33R-10016, is also available for use as a blocking control in assays to test for specificity of this KIRREL2 antibody

Images

Western Blot analysis using KIRREL2 antibody (70R-6136)

KIRREL2 antibody (70R-6136) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 67 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of KIRREL2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance KIRREL2 is a single-pass type I membrane protein. KIRREL2 protein is a beta-cell-expressed Ig domain protein and may be involved in pancreas development or beta cell function.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using KIRREL2 antibody (70R-6136) | KIRREL2 antibody (70R-6136) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors