KITLG antibody (70R-6096)

Rabbit polyclonal KITLG antibody raised against the middle region of KITLG

Synonyms Polyclonal KITLG antibody, Anti-KITLG antibody, SF antibody, KL-1 antibody, SCF antibody, Kitl antibody, Kit Ligand antibody, DKFZp686F2250 antibody, MGF antibody
Specificity KITLG antibody was raised against the middle region of KITLG
Cross Reactivity Human,Mouse,Rat,Dog
Applications WB
Immunogen KITLG antibody was raised using the middle region of KITLG corresponding to a region with amino acids TKPFMLPPVAASSLRNDSSSSNRKAKNPPGDSSLHWAAMALPALFSLIIG
Assay Information KITLG Blocking Peptide, catalog no. 33R-9145, is also available for use as a blocking control in assays to test for specificity of this KITLG antibody

Images

Immunohistochemical staining using KITLG antibody (70R-6096)

KITLG antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 28 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of KITLG antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance KITLG is the ligand of the tyrosine-kinase receptor encoded by the KIT locus. This ligand is a pleiotropic factor that acts in utero in germ cell and neural cell development, and hematopoiesis, all believed to reflect a role in cell migration. In adults, it functions pleiotropically, while mostly noted for its continued requirement in hematopoiesis.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Immunohistochemical staining using KITLG antibody (70R-6096) | KITLG antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X
  • Western Blot analysis using KITLG antibody (70R-6096) | KITLG antibody (70R-6096) used at 1 ug/ml to detect target protein.
  • Immunohistochemical staining using KITLG antibody (70R-6096) | KITLG antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors