KLHDC2 antibody (70R-3738)

Rabbit polyclonal KLHDC2 antibody raised against the N terminal of KLHDC2

Synonyms Polyclonal KLHDC2 antibody, Anti-KLHDC2 antibody, HCLP-1 antibody, Kelch Domain Containing 2 antibody, LCP antibody, KLHDC 2 antibody, KLHDC2, KLHDC-2, KLHDC-2 antibody, KLHDC 2
Specificity KLHDC2 antibody was raised against the N terminal of KLHDC2
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen KLHDC2 antibody was raised using the N terminal of KLHDC2 corresponding to a region with amino acids VSDGRHMFVWGGYKSNQVRGLYDFYLPREELWIYNMETGRWKKINTEGDV
Assay Information KLHDC2 Blocking Peptide, catalog no. 33R-9800, is also available for use as a blocking control in assays to test for specificity of this KLHDC2 antibody


Western Blot analysis using KLHDC2 antibody (70R-3738)

KLHDC2 antibody (70R-3738) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 46 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of KLHDC2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance KLHDC2 represses CREB3-mediated transcription by interfering with CREB3-DNA binding. It contains 6 Kelch repeats.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using KLHDC2 antibody (70R-3738) | KLHDC2 antibody (70R-3738) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors