KLHDC4 antibody (70R-5482)

Rabbit polyclonal KLHDC4 antibody raised against the N terminal of KLHDC4

Synonyms Polyclonal KLHDC4 antibody, Anti-KLHDC4 antibody, KLHDC 4, FLJ00104 antibody, KLHDC 4 antibody, KLHDC-4, Kelch Domain Containing 4 antibody, KLHDC-4 antibody, DKFZp434G0522 antibody, KLHDC4
Specificity KLHDC4 antibody was raised against the N terminal of KLHDC4
Cross Reactivity Human,Mouse
Applications WB
Immunogen KLHDC4 antibody was raised using the N terminal of KLHDC4 corresponding to a region with amino acids MGKKGKKEKKGRGAEKTAAKMEKKVSKRSRKEEEDLEALIAHFQTLDAKR
Assay Information KLHDC4 Blocking Peptide, catalog no. 33R-6041, is also available for use as a blocking control in assays to test for specificity of this KLHDC4 antibody

Images

Western Blot analysis using KLHDC4 antibody (70R-5482)

KLHDC4 antibody (70R-5482) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 58 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of KLHDC4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance KLHDC4 is involved in protein binding.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using KLHDC4 antibody (70R-5482) | KLHDC4 antibody (70R-5482) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors