KLHDC8A antibody (70R-4854)

Rabbit polyclonal KLHDC8A antibody raised against the middle region of KLHDC8A

Synonyms Polyclonal KLHDC8A antibody, Anti-KLHDC8A antibody, FLJ10748 antibody, KLHDCA-8 antibody, KLHDCA 8, KLHDC8A, KLHDCA 8 antibody, Kelch Domain Containing 8A antibody, KLHDCA-8
Specificity KLHDC8A antibody was raised against the middle region of KLHDC8A
Cross Reactivity Human
Applications WB
Immunogen KLHDC8A antibody was raised using the middle region of KLHDC8A corresponding to a region with amino acids NQPTVLETAEAFHPGKNKWEILPAMPTPRCACSSIVVKNCLLAVGGVNQG
Assay Information KLHDC8A Blocking Peptide, catalog no. 33R-6843, is also available for use as a blocking control in assays to test for specificity of this KLHDC8A antibody


Western Blot analysis using KLHDC8A antibody (70R-4854)

KLHDC8A antibody (70R-4854) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 39 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of KLHDC8A antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of KLHDC8A protein is not widely studied, and is yet to be elucidated fully.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using KLHDC8A antibody (70R-4854) | KLHDC8A antibody (70R-4854) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors