KLHL23 antibody (70R-4922)

Rabbit polyclonal KLHL23 antibody

Synonyms Polyclonal KLHL23 antibody, Anti-KLHL23 antibody, MGC22679 antibody, FLJ37812 antibody, MGC2610 antibody, KLHL-23, Kelch-Like 23 antibody, KLHL-23 antibody, KLHL 23, DITHP antibody, KLHL23, KLHL 23 antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen KLHL23 antibody was raised using a synthetic peptide corresponding to a region with amino acids TYDKVQSYNSDINEWSLITSSPHPEYGLCSVPFENKLYLVGGQTTITECY
Assay Information KLHL23 Blocking Peptide, catalog no. 33R-9387, is also available for use as a blocking control in assays to test for specificity of this KLHL23 antibody

Images

Western blot analysis using KLHL23 antibody (70R-4922)

Recommended KLHL23 Antibody Titration: 0.2-1 ug/ml

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 64 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of KLHL23 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This protein mediates protein binding.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western blot analysis using KLHL23 antibody (70R-4922) | Recommended KLHL23 Antibody Titration: 0.2-1 ug/ml

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors