KLHL31 antibody (70R-6296)

Rabbit polyclonal KLHL31 antibody

Synonyms Polyclonal KLHL31 antibody, Anti-KLHL31 antibody, KLHL 31 antibody, bA345L23.2 antibody, KLHL antibody, KLHL-31, BKLHD6 antibody, KLHL31, Kelch-Like 31 antibody, KLHL-31 antibody, KLHL 31
Cross Reactivity Human,Mouse,Rat,Dog
Applications IHC, WB
Immunogen KLHL31 antibody was raised using a synthetic peptide corresponding to a region with amino acids TPRGWHCAVTLSDRVYVMGGSQLGPRGERVDVLTVECYSPATGQWSYAAP
Assay Information KLHL31 Blocking Peptide, catalog no. 33R-9231, is also available for use as a blocking control in assays to test for specificity of this KLHL31 antibody

Images

Immunohistochemical staining using KLHL31 antibody (70R-6296)

KLHL31 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Skeletal muscle cells (arrows) in Human Muscle. Magnification is at 400X

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 70 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of KLHL31 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance KLHL31 is a transcriptional repressor in MAPK/JNK signaling pathway to regulate cellular functions. Overexpression inhibits the transcriptional activities of both the TPA-response element (TRE) and serum response element (SRE)

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Immunohistochemical staining using KLHL31 antibody (70R-6296) | KLHL31 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Skeletal muscle cells (arrows) in Human Muscle. Magnification is at 400X
  • Western Blot analysis using KLHL31 antibody (70R-6296) | KLHL31 antibody (70R-6296) used at 0.5 ug/ml to detect target protein.

Availability: In stock

Price: $375.00
Size: 50 ug
OR
Shipping
View Our Distributors