KLHL32 antibody (70R-3205)

Rabbit polyclonal KLHL32 antibody

Synonyms Polyclonal KLHL32 antibody, Anti-KLHL32 antibody, Kelch-Like 32 antibody, MGC51280 antibody, RP1-39B17.1 antibody, KIAA1900 antibody, KLHL-32, MGC87753 antibody, UG0030H05 antibody, KLHL 32 antibody, BKLHD5 antibody, KLHL-32 antibody, KLHL 32, dJ21F7.1 antibody, KLHL32
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen KLHL32 antibody was raised using a synthetic peptide corresponding to a region with amino acids DVSREGKEEVFYGPTLPFASNGIAACFLPAPYFTCPNLQTLQVPHHRIGT
Assay Information KLHL32 Blocking Peptide, catalog no. 33R-2225, is also available for use as a blocking control in assays to test for specificity of this KLHL32 antibody

Images

Western Blot analysis using KLHL32 antibody (70R-3205)

KLHL32 antibody (70R-3205) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 70 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of KLHL32 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The specific function of KLHL32 is not yet known.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using KLHL32 antibody (70R-3205) | KLHL32 antibody (70R-3205) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors