KLHL7 antibody (70R-3853)

Rabbit polyclonal KLHL7 antibody

Synonyms Polyclonal KLHL7 antibody, Anti-KLHL7 antibody, KLHL 7, KLHL7, KLHL-7, SBBI26 antibody, KLHL 7 antibody, KLHL-7 antibody, KLHL6 antibody, Kelch-Like 7 antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen KLHL7 antibody was raised using a synthetic peptide corresponding to a region with amino acids AVGSIVYVLAGFQGVGRLGHILEYNTETDKWVANSKVRAFPVTSCLICVV
Assay Information KLHL7 Blocking Peptide, catalog no. 33R-1597, is also available for use as a blocking control in assays to test for specificity of this KLHL7 antibody

Images

Western Blot analysis using KLHL7 antibody (70R-3853)

KLHL7 antibody (70R-3853) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 62 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of KLHL7 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Defects in KLHL7 are the cause of retinitis pigmentosa type 42 (RP42). The specific function of this protein remains unknown.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using KLHL7 antibody (70R-3853) | KLHL7 antibody (70R-3853) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors