KLK-BL4 antibody (70R-3789)

Rabbit polyclonal KLK-BL4 antibody raised against the C terminal Of Klkbl4

Synonyms Polyclonal KLK-BL4 antibody, Anti-KLK-BL4 antibody, KLK-BL4, Kallikrein BL4 antibody, KLKBL4 antibody, FLJ25339 antibody, KLK-BL 4, KLK-BL-4, KLK-BL 4 antibody, KLK-BL-4 antibody
Specificity KLK-BL4 antibody was raised against the C terminal Of Klkbl4
Cross Reactivity Human
Applications WB
Immunogen KLK-BL4 antibody was raised using the C terminal Of Klkbl4 corresponding to a region with amino acids EASVQPLYYDYYGGEVGEGRIFAGQNRLYQPEEIILVSFVLVFFCSSI
Assay Information KLK-BL4 Blocking Peptide, catalog no. 33R-2284, is also available for use as a blocking control in assays to test for specificity of this KLK-BL4 antibody

Images

Western Blot analysis using KLK-BL4 antibody (70R-3789)

KLK-BL4 antibody (70R-3789) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 44 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of KLKBL4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Klkbl4 is a secreted protein. Klkbl4 belongs to the peptidase S1 family, plasma kallikrein subfamily. It contains 1 peptidase S1 domain.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using KLK-BL4 antibody (70R-3789) | KLK-BL4 antibody (70R-3789) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors