KLK10 protein (30R-3282)

Purified recombinant KLK10 protein

Synonyms Normal epithelial cell specific 1 protein, Protease serine like 1 protein, Kallikrein 10 protein, KLK 10 protein, KLK-10 protein
Species Human
Protein Type Recombinant
Applications ELISA, SDS-PAGE, WB

Specifications

Residues EGAVLPRSAKELRCQCIKTYEGAVLPRSAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVESKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVE
Expression System E.coli
Purity > 90% pure
Molecular Weight 34 kDa
Form & Buffer Supplied in liquid form in PBS buffer

Storage & Safety

Storage Store at 4 deg C in a working aliquot for 1 week. For long term storage, aliquot and freeze at -20 to -80 deg C, avoid repeat freeze/thaw cycles

General Information

Biological Significance KLK10 has a tumor-suppressor role for NES1 in breast and prostate cancer.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: $210.00
Size: 50 ug
OR
Shipping
View Our Distributors