KLK13 antibody (70R-3265)

Rabbit polyclonal KLK13 antibody raised against the middle region of KLK13

Synonyms Polyclonal KLK13 antibody, Anti-KLK13 antibody, DKFZP586J1923 antibody, KLKL4 antibody, KLK-L4 antibody, Kallikrein-Related Peptidase 13 antibody, KLK-13, KLK 13 antibody, KLK13, KLK 13, KLK-13 antibody
Specificity KLK13 antibody was raised against the middle region of KLK13
Cross Reactivity Human
Applications WB
Immunogen KLK13 antibody was raised using the middle region of KLK13 corresponding to a region with amino acids VLTAAHCLKEGLKVYLGKHALGRVEAGEQVREVVHSIPHPEYRRSPTHLN
Assay Information KLK13 Blocking Peptide, catalog no. 33R-9689, is also available for use as a blocking control in assays to test for specificity of this KLK13 antibody

Images

Western Blot analysis using KLK13 antibody (70R-3265)

KLK13 antibody (70R-3265) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 29 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of KLK13 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Kallikreins are a subgroup of serine proteases having diverse physiological functions. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers. This gene is one of the fifteen kallikrein subfamily members located in a cluster on chromosome 19. Expression of this gene is regulated by steroid hormones and may be useful as a marker for breast cancer. An additional transcript variant has been identified, but its full length sequence has not been determined.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using KLK13 antibody (70R-3265) | KLK13 antibody (70R-3265) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors