KLK2 antibody (70R-3860)

Rabbit polyclonal KLK2 antibody raised against the middle region of KLK2

Synonyms Polyclonal KLK2 antibody, Anti-KLK2 antibody, KLK-2 antibody, KLK 2, KLK-2, KLK 2 antibody, Kallikrein-Related Peptidase 2 antibody, KLK2, hK2 antibody, KLK2A2 antibody, MGC12201 antibody
Specificity KLK2 antibody was raised against the middle region of KLK2
Cross Reactivity Human
Applications WB
Immunogen KLK2 antibody was raised using the middle region of KLK2 corresponding to a region with amino acids KHQSLRPDEDSSHDLMLLRLSEPAKITDVVKVLGLPTQEPALGTTCYASG
Assay Information KLK2 Blocking Peptide, catalog no. 33R-4419, is also available for use as a blocking control in assays to test for specificity of this KLK2 antibody

Images

Western blot analysis using KLK2 antibody (70R-3860)

Recommended KLK2 Antibody Titration: 0.2-1 ug/ml

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 25 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of KLK2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.2-1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Glandular kallikreins cleave Met-Lys and Arg-Ser bonds in kininogen to release Lys-bradykinin.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western blot analysis using KLK2 antibody (70R-3860) | Recommended KLK2 Antibody Titration: 0.2-1 ug/ml

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors