KLK5 antibody (70R-6355)

Rabbit polyclonal KLK5 antibody raised against the N terminal of KLK5

Synonyms Polyclonal KLK5 antibody, Anti-KLK5 antibody, KLK-5, KLKL2 antibody, KLK 5, KLK-5 antibody, KLK5, KLK 5 antibody, Kallikrein-Related Peptidase 5 antibody, KLK-L2 antibody, SCTE antibody
Specificity KLK5 antibody was raised against the N terminal of KLK5
Cross Reactivity Human
Applications WB
Immunogen KLK5 antibody was raised using the N terminal of KLK5 corresponding to a region with amino acids CDHPSNTVPSGSNQDLGAGAGEDARSDDSSSRIINGSDCDMHTQPWQAAL
Assay Information KLK5 Blocking Peptide, catalog no. 33R-1662, is also available for use as a blocking control in assays to test for specificity of this KLK5 antibody

Images

Western Blot analysis using KLK5 antibody (70R-6355)

KLK5 antibody (70R-6355) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 25 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of KLK5 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Kallikreins are a subgroup of serine proteases having diverse physiological functions. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using KLK5 antibody (70R-6355) | KLK5 antibody (70R-6355) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors