Klotho antibody (70R-7494)

Rabbit polyclonal KL antibody raised against the middle region of KL

Synonyms Polyclonal Klotho antibody, Anti-Klotho antibody, KL antibody
Specificity Klotho antibody was raised against the middle region of KL
Cross Reactivity Human,Rat
Applications WB
Immunogen Klotho antibody was raised using the middle region of KL corresponding to a region with amino acids HAQNGKISIALQADWIEPACPFSQKDKEVAERVLEFDIGWLAEPIFGSGD
Assay Information Klotho Blocking Peptide, catalog no. 33R-3695, is also available for use as a blocking control in assays to test for specificity of this Klotho antibody

Images

Immunohistochemical staining using Klotho antibody (70R-7494)

prostate

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 116 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of KL antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance KL is a type-I membrane protein that is related to beta-glucosidases. Reduced production of this protein has been observed in patients with chronic renal failure (CRF), and this may be one of the factors underlying the degenerative processes (e.g., arteriosclerosis, osteoporosis, and skin atrophy) seen in CRF. Also, mutations within this protein have been associated with ageing and bone loss.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Immunohistochemical staining using Klotho antibody (70R-7494) | prostate

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors