Klotho Beta antibody (70R-7053)

Rabbit polyclonal KLB antibody raised against the middle region of KLB

Synonyms Polyclonal Klotho Beta antibody, Anti-Klotho Beta antibody, KLB antibody, MGC142213 antibody, BKL antibody
Specificity Klotho Beta antibody was raised against the middle region of KLB
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen Klotho Beta antibody was raised using the middle region of KLB corresponding to a region with amino acids DAYTIRRGLFYVDFNSKQKERKPKSSAHYYKQIIRENGFSLKESTPDVQG
Assay Information Klotho Beta Blocking Peptide, catalog no. 33R-1868, is also available for use as a blocking control in assays to test for specificity of this Klotho Beta antibody

Images

Immunohistochemical staining using Klotho Beta antibody (70R-7053)

Klotho Beta antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 120 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of KLB antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance KLB is a single-pass type III membrane protein. It contributes to the transcriptional repression of cholesterol 7-alpha-hydroxylase (CYP7A1), the rate-limiting enzyme in bile acid synthesis. KLB is probably inactive as a glycosidase. It increases the ability of FGFR1 and FGFR4 to bind FGF21.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Immunohistochemical staining using Klotho Beta antibody (70R-7053) | Klotho Beta antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X
  • Western Blot analysis using Klotho Beta antibody (70R-7053) | Klotho Beta antibody (70R-7053) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $375.00
Size: 50 ug
OR
Shipping
View Our Distributors