KLRF1 antibody (70R-5966)

Rabbit polyclonal KLRF1 antibody raised against the middle region of KLRF1

Synonyms Polyclonal KLRF1 antibody, Anti-KLRF1 antibody, Killer Cell Lectin-Like Receptor Subfamily F Member 1 antibody, KLRF-1 antibody, KLRF-1, KLRF 1, KLRF 1 antibody, MGC119909 antibody, MGC119907 antibody, KLRF1, CLEC5C antibody, MGC119908 antibody
Specificity KLRF1 antibody was raised against the middle region of KLRF1
Cross Reactivity Human
Applications WB
Immunogen KLRF1 antibody was raised using the middle region of KLRF1 corresponding to a region with amino acids QKGSCSNATQYEDTGDLKVNNGTRRNISNKDLCASRSADQTVLCQSEWLK
Assay Information KLRF1 Blocking Peptide, catalog no. 33R-7602, is also available for use as a blocking control in assays to test for specificity of this KLRF1 antibody

Images

Western Blot analysis using KLRF1 antibody (70R-5966)

KLRF1 antibody (70R-5966) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 26 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of KLRF1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance KLRF1, an activating homodimeric C-type lectin-like receptor (CTLR), is expressed on nearly all natural killer (NK) cells and stimulates their cytoxicity and cytokine release.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using KLRF1 antibody (70R-5966) | KLRF1 antibody (70R-5966) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors