KRAS antibody (70R-5673)

Rabbit polyclonal KRAS antibody raised against the N terminal of KRAS

Synonyms Polyclonal KRAS antibody, Anti-KRAS antibody, K-RAS4B antibody, RASK2 antibody, V-Ki-Ras2 Kirsten Rat Sarcoma Viral Oncogene Homolog antibody, KRAS1 antibody, K-RAS2A antibody, NS3 antibody, C-K-RAS antibody, K-RAS4A antibody, KRAS2 antibody, K-RAS2B antibody, KI-RAS antibody
Specificity KRAS antibody was raised against the N terminal of KRAS
Cross Reactivity Human,Mouse,Rat,Drosophila
Applications WB
Immunogen KRAS antibody was raised using the N terminal of KRAS corresponding to a region with amino acids TEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETC
Assay Information KRAS Blocking Peptide, catalog no. 33R-9058, is also available for use as a blocking control in assays to test for specificity of this KRAS antibody

Images

Western Blot analysis using KRAS antibody (70R-5673)

KRAS antibody (70R-5673) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 22 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of KRAS antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance KRAS is a member of the small GTPase superfamily. A single amino acid substitution is responsible for an activating mutation. The transforming protein that results is implicated in various malignancies, including lung adenocarcinoma, mucinous adenoma, ductal carcinoma of the pancreas and colorectal carcinoma.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using KRAS antibody (70R-5673) | KRAS antibody (70R-5673) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors