KRT19 protein (30R-3287)

Purified recombinant KRT19 protein

Synonyms Cytokeratin 19 protein, CK 19 protein, Keratin 19 protein, K 19 protein, K-19 protein, Keratin type I cytoskeletal 19 protein, KRT 19 protein, KRT-19 protein
Species Human
Protein Type Recombinant
Applications ELISA, SDS-PAGE, WB

Images

SDS-PAGE analysis of KRT19 protein (30R-3287)

Specifications

Residues KFLEGAVLPRSAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKRAENS
Expression System E.coli
Purity > 90% pure
Molecular Weight 21 kDa
Form & Buffer Supplied in liquid form in 20mM Tris-Hcl, 0.5MNaCl, 10% glycerin (pH 8.0) and 200 mM Imidazole

Storage & Safety

Storage Store at 4 deg C in a working aliquot for 1 week. For long term storage, aliquot and freeze at -20 to -80 deg C, avoid repeat freeze/thaw cycles

General Information

Biological Significance KRT19 is involved in the organization of myofibers. Together with KRT8, helps to link the contractile apparatus to dystrophin at the costameres of striated muscle.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • SDS-PAGE analysis of KRT19 protein (30R-3287)

Availability: In stock

Price: $210.00
Size: 50 ug
OR
Shipping
View Our Distributors