KYNU antibody (70R-3487)

Rabbit polyclonal KYNU antibody

Synonyms Polyclonal KYNU antibody, Anti-KYNU antibody, L-Kynurenine Hydrolase antibody, Kynureninase antibody
Cross Reactivity Human
Applications IHC, WB
Immunogen KYNU antibody was raised using a synthetic peptide corresponding to a region with amino acids LAHAVGNVELYLHDWGVDFACWCSYKYLNAGAGGIAGAFIHEKHAHTIKP
Assay Information KYNU Blocking Peptide, catalog no. 33R-4774, is also available for use as a blocking control in assays to test for specificity of this KYNU antibody

Images

Immunohistochemical staining using KYNU antibody (70R-3487)

KYNU antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Hepatocytes (arrows) in Human Liver. Magnification is at 400X

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 52 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of KYNU antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.25 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Kynureninase is a pyridoxal-5'-phosphate (pyridoxal-P) dependent enzyme that catalyzes the cleavage of L-kynurenine and L-3-hydroxykynurenine into anthranilic and 3-hydroxyanthranilic acids, respectively. Kynureninase is involved in the biosynthesis of NAD cofactors from tryptophan through the kynurenine pathway.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Immunohistochemical staining using KYNU antibody (70R-3487) | KYNU antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Hepatocytes (arrows) in Human Liver. Magnification is at 400X
  • Western Blot analysis using KYNU antibody (70R-3487) | KYNU antibody (70R-3487) used at 0.25 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors