Lamin B Receptor antibody (70R-6757)

Rabbit polyclonal Lamin B Receptor antibody raised against the middle region of LBR

Synonyms Polyclonal Lamin B Receptor antibody, Anti-Lamin B Receptor antibody, MGC9041 antibody, DHCR14B antibody, LBR antibody, PHA antibody, LMN2R antibody
Specificity Lamin B Receptor antibody was raised against the middle region of LBR
Cross Reactivity Human
Applications WB
Immunogen Lamin B Receptor antibody was raised using the middle region of LBR corresponding to a region with amino acids GANSQKNAFRKNPSDPKLAHLKTIHTSTGKNLLVSGWWGFVRHPNYLGDL
Assay Information Lamin B Receptor Blocking Peptide, catalog no. 33R-3164, is also available for use as a blocking control in assays to test for specificity of this Lamin B Receptor antibody

Images

Western Blot analysis using Lamin B Receptor antibody (70R-6757)

Lamin B Receptor antibody (70R-6757) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 71 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LBR antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The protein encoded by this gene belongs to the ERG4/ERG24 family. It is localized in the nuclear envelope inner membrane and anchors the lamina and the heterochromatin to the membrane. It may mediate interaction between chromatin and lamin B. Mutations of this gene has been associated with autosomal recessive HEM/Greenberg skeletal dysplasia. Alternative splicing occurs at this locus and two transcript variants encoding the same protein have been identified.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using Lamin B Receptor antibody (70R-6757) | Lamin B Receptor antibody (70R-6757) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors