Laminin Gamma 1 antibody (70R-6061)

Rabbit polyclonal Laminin Gamma 1 antibody

Synonyms Polyclonal Laminin Gamma 1 antibody, Anti-Laminin Gamma 1 antibody, LAMC1 antibody, LAMB2 antibody, Lamb2 antibody, MGC87297 antibody
Cross Reactivity Human
Applications WB
Immunogen Laminin Gamma 1 antibody was raised using a synthetic peptide corresponding to a region with amino acids GYHVKTEDPDLRTSSWIKQFDTSRFHPQDLSRSQKCIRKEGSSEISQRVQ
Assay Information Laminin Gamma 1 Blocking Peptide, catalog no. 33R-3677, is also available for use as a blocking control in assays to test for specificity of this Laminin Gamma 1 antibody


Western Blot analysis using Laminin Gamma 1 antibody (70R-6061)

Laminin Gamma 1 antibody (70R-6061) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 177 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LAMC1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Laminin is a complex glycoprotein, consisting of three different polypeptide chains (alpha, beta, gamma), which are bound to each other by disulfide bonds into a cross-shaped molecule comprising one long and three short arms with globules at each end. Binding to cells via a high affinity receptor, laminin is thought to mediate the attachment, migration and organization of cells into tissues during embryonic development by interacting with other extracellular matrix components.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using Laminin Gamma 1 antibody (70R-6061) | Laminin Gamma 1 antibody (70R-6061) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors