LAPTM4A antibody (70R-1814)

Rabbit polyclonal LAPTM4A antibody raised against the middle region of LAPTM4A

Synonyms Polyclonal LAPTM4A antibody, Anti-LAPTM4A antibody, LAPTMA 4, MBNT antibody, Lysosomal-Associated Protein Transmembrane 4 Alpha antibody, Mtrp antibody, LAPTMA-4, HUMORF13 antibody, LAPTM4A, KIAA0108 antibody, LAPTMA 4 antibody, LAPTM4 antibody, LAPTMA-4 antibody
Specificity LAPTM4A antibody was raised against the middle region of LAPTM4A
Cross Reactivity Human,Mouse,Rat,Dog
Applications WB
Immunogen LAPTM4A antibody was raised using the middle region of LAPTM4A corresponding to a region with amino acids VLSCLVAISSLTYLPRIKEYLDQLPDFPYKDDLLALDSSCLLFIVLVFFA
Assay Information LAPTM4A Blocking Peptide, catalog no. 33R-9682, is also available for use as a blocking control in assays to test for specificity of this LAPTM4A antibody


Western Blot analysis using LAPTM4A antibody (70R-1814)

LAPTM4A antibody (70R-1814) used at 5 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 27 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of LAPTM4A antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance LAPTM4A is a protein that has four predicted transmembrane domains. The function of its gene has not yet been determined; however, studies in the mouse homolog suggest a role in the transport of small molecules across endosomal and lysosomal membranes.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using LAPTM4A antibody (70R-1814) | LAPTM4A antibody (70R-1814) used at 5 ug/ml to detect target protein.

Availability: In stock

Price: $275.00
Size: 100 ug
View Our Distributors