LAPTM4B antibody (70R-6318)

Rabbit polyclonal LAPTM4B antibody raised against the middle region of LAPTM4B

Synonyms Polyclonal LAPTM4B antibody, Anti-LAPTM4B antibody, LAPTM4beta antibody, Lysosomal Associated Protein Transmembrane 4 Beta antibody, LAPTMB 4, LAPTMB-4 antibody, LAPTMB 4 antibody, LAPTMB-4, LAPTM4B, LC27 antibody
Specificity LAPTM4B antibody was raised against the middle region of LAPTM4B
Cross Reactivity Human
Applications WB
Immunogen LAPTM4B antibody was raised using the middle region of LAPTM4B corresponding to a region with amino acids YPNSIQEYIRQLPPNFPYRDDVMSVNPTCLVLIILLFISIILTFKGYLIS
Assay Information LAPTM4B Blocking Peptide, catalog no. 33R-10204, is also available for use as a blocking control in assays to test for specificity of this LAPTM4B antibody

Images

Western Blot analysis using LAPTM4B antibody (70R-6318)

LAPTM4B antibody (70R-6318) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 35 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LAPTM4B antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance LAPTM4B is a multi-pass membrane protein. It belongs to the LAPTM4/LAPTM5 transporter family. LAPTM4b has active role in disease progression of malignant cells and is involved in cell proliferation and multidrug resistance. The genetic polymorphism of LAPTM4B is a potential risk factor for the development of colon cancer and gastric cancer. The research results also indicated that LAPTM4B may be a clinically useful prognostic indicator for ovarian carcinoma and may play a role in human hepatocellular carcinoma.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using LAPTM4B antibody (70R-6318) | LAPTM4B antibody (70R-6318) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors