LARGE antibody (70R-6856)

Rabbit polyclonal LARGE antibody raised against the middle region of LARGE

Synonyms Polyclonal LARGE antibody, Anti-LARGE antibody, MDC1D antibody, KIAA0609 antibody, Like-Glycosyltransferase antibody
Specificity LARGE antibody was raised against the middle region of LARGE
Cross Reactivity Human
Applications WB
Immunogen LARGE antibody was raised using the middle region of LARGE corresponding to a region with amino acids AHIMELDVQEYEFIVLPNAYMIHMPHAPSFDITKFRSNKQYRICLKTLKE
Assay Information LARGE Blocking Peptide, catalog no. 33R-1247, is also available for use as a blocking control in assays to test for specificity of this LARGE antibody

Images

Western Blot analysis using LARGE antibody (70R-6856)

LARGE antibody (70R-6856) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 88 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LARGE antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene, which is one of the largest in the human genome, encodes a glycosyltransferase which participates in glycosylation of alpha-dystroglycan.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using LARGE antibody (70R-6856) | LARGE antibody (70R-6856) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $375.00
Size: 50 ug
OR
Shipping
View Our Distributors