LASS1 antibody (70R-6641)

Rabbit polyclonal LASS1 antibody raised against the middle region of LASS1

Synonyms Polyclonal LASS1 antibody, Anti-LASS1 antibody, LASS 1, LAG1 antibody, MGC90349 antibody, CerS1 antibody, LASS1, LASS-1, UOG1 antibody, LASS-1 antibody, Lag1 Homolog Ceramide Synthase 1 antibody, LASS 1 antibody
Specificity LASS1 antibody was raised against the middle region of LASS1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen LASS1 antibody was raised using the middle region of LASS1 corresponding to a region with amino acids LYIVAFAAKVLTGQVHELKDLREYDTAEAQSLKPSKAEKPLRNGLVKDKR
Assay Information LASS1 Blocking Peptide, catalog no. 33R-5564, is also available for use as a blocking control in assays to test for specificity of this LASS1 antibody

Images

Western Blot analysis using LASS1 antibody (70R-6641)

LASS1 antibody (70R-6641) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 39 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LASS1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes a member of the bone morphogenetic protein (BMP) family and the TGF-beta superfamily.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using LASS1 antibody (70R-6641) | LASS1 antibody (70R-6641) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors