LAX1 antibody (70R-6590)

Rabbit polyclonal LAX1 antibody raised against the middle region of LAX1

Synonyms Polyclonal LAX1 antibody, Anti-LAX1 antibody, LAX-1, LAX1, Lymphocyte Transmembrane Adaptor 1 antibody, LAX 1, LAX-1 antibody, FLJ20340 antibody, LAX 1 antibody, LAX antibody
Specificity LAX1 antibody was raised against the middle region of LAX1
Cross Reactivity Human
Applications WB
Immunogen LAX1 antibody was raised using the middle region of LAX1 corresponding to a region with amino acids LFVLPSTQKLEFTEERDEGCGDAGDCTSLYSPGAEDSDSLSNGEGSSQIS
Assay Information LAX1 Blocking Peptide, catalog no. 33R-4955, is also available for use as a blocking control in assays to test for specificity of this LAX1 antibody

Images

Western Blot analysis using LAX1 antibody (70R-6590)

LAX1 antibody (70R-6590) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 44 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LAX1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance LAX1 is a single-pass type III membrane protein. It negatively regulates TCR (T-cell antigen receptor)-mediated signaling in T-cells and BCR (B-cell antigen receptor)-mediated signaling in B-cells.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using LAX1 antibody (70R-6590) | LAX1 antibody (70R-6590) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors