LBP antibody (70R-5906)

Rabbit polyclonal LBP antibody raised against the C terminal of LBP

Synonyms Polyclonal LBP antibody, Anti-LBP antibody, Lipopolysaccharide Binding Protein antibody, MGC22233 antibody
Specificity LBP antibody was raised against the C terminal of LBP
Cross Reactivity Human
Applications WB
Immunogen LBP antibody was raised using the C terminal of LBP corresponding to a region with amino acids FLKPGKVKVELKESKVGLFNAELLEALLNYYILNTFYPKFNDKLAEGFPL
Assay Information LBP Blocking Peptide, catalog no. 33R-2965, is also available for use as a blocking control in assays to test for specificity of this LBP antibody

Images

Western Blot analysis using LBP antibody (70R-5906)

LBP antibody (70R-5906) used at 0.25 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 51 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LBP antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance LBP is involved in the acute-phase immunologic response to gram-negative bacterial infections. Gram-negative bacteria contain a glycolipid, lipopolysaccharide (LPS), on their outer cell wall. Together with bactericidal permeability-increasing protein (BPI), the protein binds LPS and interacts with the CD14 receptor, probably playing a role in regulating LPS-dependent monocyte responses.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using LBP antibody (70R-5906) | LBP antibody (70R-5906) used at 0.25 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors