LBP antibody (70R-5907)

Rabbit polyclonal LBP antibody raised against the middle region of LBP

Synonyms Polyclonal LBP antibody, Anti-LBP antibody, Lipopolysaccharide Binding Protein antibody, MGC22233 antibody
Specificity LBP antibody was raised against the middle region of LBP
Cross Reactivity Human
Applications WB
Immunogen LBP antibody was raised using the middle region of LBP corresponding to a region with amino acids LLGSESSGRPTVTASSCSSDIADVEVDMSGDLGWLLNLFHNQIESKFQKV
Assay Information LBP Blocking Peptide, catalog no. 33R-5143, is also available for use as a blocking control in assays to test for specificity of this LBP antibody

Images

Western Blot analysis using LBP antibody (70R-5907)

LBP antibody (70R-5907) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 51 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LBP antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance LBP is involved in the acute-phase immunologic response to gram-negative bacterial infections. Gram-negative bacteria contain a glycolipid, lipopolysaccharide (LPS), on their outer cell wall. Together with bactericidal permeability-increasing protein (BPI), the protein binds LPS and interacts with the CD14 receptor, probably playing a role in regulating LPS-dependent monocyte responses.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using LBP antibody (70R-5907) | LBP antibody (70R-5907) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors