LCAT antibody (70R-7207)

Rabbit polyclonal LCAT antibody raised against the C terminal of LCAT

Synonyms Polyclonal LCAT antibody, Anti-LCAT antibody, Lecithin-Cholesterol Acyltransferase antibody
Specificity LCAT antibody was raised against the C terminal of LCAT
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen LCAT antibody was raised using the C terminal of LCAT corresponding to a region with amino acids GVLYEDGDDTVATRSTELCGLWQGRQPQPVHLLPLHGIQHLNMVFSNLTL
Assay Information LCAT Blocking Peptide, catalog no. 33R-3643, is also available for use as a blocking control in assays to test for specificity of this LCAT antibody


Western Blot analysis using LCAT antibody (70R-7207)

LCAT antibody (70R-7207) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 47 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LCAT antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance LCAT is an extracellular cholesterol esterifying enzyme, lecithin-cholesterol acyltransferase. The esterification of cholesterol is required for cholesterol transport. Mutations in its gene have been found to cause fish-eye disease as well as LCAT deficiency.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using LCAT antibody (70R-7207) | LCAT antibody (70R-7207) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors